Lineage for d1teda1 (1ted A:22-246)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2523777Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2523778Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2524267Family c.95.1.2: Chalcone synthase-like [53914] (9 proteins)
  6. 2524505Protein Polyketide synthase PKS18 [110758] (1 species)
  7. 2524506Species Mycobacterium tuberculosis [TaxId:1773] [110759] (2 PDB entries)
    Uniprot Q79FQ0
  8. 2524507Domain d1teda1: 1ted A:22-246 [238542]
    complexed with myr

Details for d1teda1

PDB Entry: 1ted (more details), 2.25 Å

PDB Description: Crystal structure of a type III polyketide synthase PKS18 from Mycobacterium tuberculosis
PDB Compounds: (A:) pks18

SCOPe Domain Sequences for d1teda1:

Sequence, based on SEQRES records: (download)

>d1teda1 c.95.1.2 (A:22-246) Polyketide synthase PKS18 {Mycobacterium tuberculosis [TaxId: 1773]}
aqlppappttvavieglatgtprrvvnqsdaadrvaelfldpgqreriprvyqksrittr
rmavdpldakfdvfrrepatirdrmhlfyehavplavdvskralaglpyraaeigllvla
tstgfiapgvdvaivkelglspsisrvvvnfmgcaaamnalgtatnyvrahpamkalvvc
ielcsvnavfaddindvvihslfgdgcaalvigasqvqeklepgk

Sequence, based on observed residues (ATOM records): (download)

>d1teda1 c.95.1.2 (A:22-246) Polyketide synthase PKS18 {Mycobacterium tuberculosis [TaxId: 1773]}
aqlppappttvavieglatgtprrvvnqsdaadrvaelgqreriprvyqksrittrrmav
dpldakfdvfrrepatirdrmhlfyehavplavdvskralaglpyraaeigllvlatstg
fiapgvdvaivkelglspsisrvvvnfmgcaaamnalgtatnyvrahpamkalvvcielc
svnavfaddindvvihslfgdgcaalvigasqvqeklepgk

SCOPe Domain Coordinates for d1teda1:

Click to download the PDB-style file with coordinates for d1teda1.
(The format of our PDB-style files is described here.)

Timeline for d1teda1: