Lineage for d1sqqe2 (1sqq E:70-196)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782333Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 2782334Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 2782335Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins)
  6. 2782420Protein automated matches [190874] (7 species)
    not a true protein
  7. 2782442Species Cow (Bos taurus) [TaxId:9913] [254898] (2 PDB entries)
  8. 2782443Domain d1sqqe2: 1sqq E:70-196 [238539]
    Other proteins in same PDB: d1sqqa1, d1sqqa2, d1sqqb1, d1sqqb2, d1sqqc1, d1sqqc2, d1sqqd1, d1sqqd2, d1sqqe1, d1sqqf1, d1sqqg_, d1sqqh_, d1sqqi_, d1sqqj_, d1sqqk1
    automated match to d1bcce1
    complexed with fes, hec, ost, uq2

Details for d1sqqe2

PDB Entry: 1sqq (more details), 3 Å

PDB Description: crystal structure analysis of bovine bc1 with methoxy acrylate stilbene (moas)
PDB Compounds: (E:) Ubiquinol-cytochrome c reductase iron-sulfur subunit, mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein) (RISP) [Contains: Ubiquinol-cytochrome c reductase 8 kDa protein (Complex III subunit IX)]

SCOPe Domain Sequences for d1sqqe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqqe2 b.33.1.1 (E:70-196) automated matches {Cow (Bos taurus) [TaxId: 9913]}
amskieiklsdipegknmafkwrgkplfvrhrtkkeidqeaavevsqlrdpqhdlervkk
pewviligvcthlgcvpianagdfggyycpchgshydasgrirkgpaplnlevpsyefts
ddmvivg

SCOPe Domain Coordinates for d1sqqe2:

Click to download the PDB-style file with coordinates for d1sqqe2.
(The format of our PDB-style files is described here.)

Timeline for d1sqqe2: