Lineage for d1shzf_ (1shz F:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719790Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
    contains a 4-helical bundle with left-handed twist and up-and-down topology
  4. 2719791Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) (S)
  5. 2719852Family a.91.1.0: automated matches [191379] (1 protein)
    not a true family
  6. 2719853Protein automated matches [190464] (3 species)
    not a true protein
  7. 2719862Species Human (Homo sapiens) [TaxId:9606] [187381] (38 PDB entries)
  8. 2719900Domain d1shzf_: 1shz F: [238533]
    Other proteins in same PDB: d1shza1, d1shza2, d1shzd1, d1shzd2
    automated match to d3cx8b_
    complexed with alf, gdp, mg

Details for d1shzf_

PDB Entry: 1shz (more details), 2.85 Å

PDB Description: crystal structure of the p115rhogef rgrgs domain in a complex with galpha(13):galpha(i1) chimera
PDB Compounds: (F:) Rho guanine nucleotide exchange factor 1

SCOPe Domain Sequences for d1shzf_:

Sequence, based on SEQRES records: (download)

>d1shzf_ a.91.1.0 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
glvpvsiigaededfeneletnseeqnsqfqsleqvkrrpahlmallqhvalqfepgpll
cclhadmlgslgpkeakkafldfyhsflektavlrvpvppnvafeldrtradlisedvqr
rfvqevvqsqqvavgrqledfrskrlmgmtpweqelaqleawvgrdrasyearerhvaer
llmhleemqhtistdeeksaavvnaiglymrhlgvrt

Sequence, based on observed residues (ATOM records): (download)

>d1shzf_ a.91.1.0 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
glvpvsiigaededfenesqfqsleqvkrrpahlmallqhvalqfepgpllcclhadmlg
pkeakkafldfyhsflektavlrvpvppnvafelvqrrfvqevvqsqqvavgrqledfrs
krlmgmtpweqelaqleawsyearerhvaerllmhleemqhtistdeeksaavvnaigly
mrhlgvrt

SCOPe Domain Coordinates for d1shzf_:

Click to download the PDB-style file with coordinates for d1shzf_.
(The format of our PDB-style files is described here.)

Timeline for d1shzf_: