SCOPe 2.08: Domain d1shzc_: 1shz C:

Lineage for d1shzc_ (1shz C:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
   multihelical; consists of two all-alpha subdomains
   contains a 4-helical bundle with left-handed twist and up-and-down topology

4. Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families)

5. Family a.91.1.0: automated matches [191379] (1 protein)
   not a true family

6. Protein automated matches [190464] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187381] (38 PDB entries)

8. Domain d1shzc_: 1shz C: [238532]
   Other proteins in same PDB: d1shza1, d1shza2, d1shzd1, d1shzd2
   automated match to d3cx8b_
   complexed with alf, gdp, mg

Details for d1shzc_

PDB Entry: 1shz, 2.85 Å

PDB Description: crystal structure of the p115rhogef rgrgs domain in a complex with galpha(13):galpha(i1) chimera

PDB Compounds: (C:) Rho guanine nucleotide exchange factor 1

SCOPe Domain Sequences for d1shzc_:

Sequence, based on SEQRES records:

>d1shzc_ a.91.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pglvpvsiigaededfeneletnseeqnsqfqsleqvkrrpahlmallqhvalqfepgpl
lcclhadmlgslgpkeakkafldfyhsflektavlrvpvppnvafeldrtradlisedvq
rrfvqevvqsqqvavgrqledfrskrlmgmtpweqelaqleawvgrdrasyearerhvae
rllmhleemqhtistdeeksaavvnaiglymrhlgvrt

Sequence, based on observed residues (ATOM records):

>d1shzc_ a.91.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pglvpvsiigaededfeneletsqfqsleqvkrrpahlmallqhvalqfepgpllcclha
dmlgskkafldfyhsflektavlrvpvppnvafeldvqrrfvqevvqsqqvavgrqledf
rskrlmgmtpweqelaqleawvgrdrasyearerhvaerllmhleemqhtistdeeksaa
vvnaiglymrhlgvrt

Timeline for d1shzc_:

• d1shzc_ first appeared in SCOPe 2.04
  
• d1shzc_ appears in SCOPe 2.07