SCOPe 2.06: Domain d1ghb.1: 1ghb F:,G:

Lineage for d1ghb.1 (1ghb F:,G:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein (alpha,gamma)-chymotrypsin(ogen) [50522] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50523] (60 PDB entries)
   Uniprot P00766

8. Domain d1ghb.1: 1ghb F:,G: [238528]
   complexed with ace, hex, ipa

Details for d1ghb.1

PDB Entry: 1ghb, 2 Å

PDB Description: a second active site in chymotrypsin? the x-ray crystal structure of n-acetyl-d-tryptophan bound to gamma-chymotrypsin

PDB Compounds: (F:) gamma-chymotrypsin, (G:) gamma-chymotrypsin

SCOPe Domain Sequences for d1ghb.1:

Sequence; same for both SEQRES and ATOM records:

>g1ghb.1 b.47.1.2 (F:,G:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvttsdvvvagefdqgs
ssekiqklkiakvfknskynsltinnditllklstaasfsqtvsavclpsasddfaagtt
cvttgwgltryXtpdrlqqaslpllsntnckkywgtkikdamicagasgvsscmgdsggp
lvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaan

Timeline for d1ghb.1:

• d1ghb.1 first appeared in SCOPe 2.04
  
• d1ghb.1 appears in SCOPe 2.05
  
• d1ghb.1 appears in SCOPe 2.07
  
• d1ghb.1 appears in the current release, SCOPe 2.08