Lineage for d3wcrb_ (3wcr B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2042198Family b.29.1.1: Legume lectins [49900] (5 protein domains)
  6. 2042739Protein automated matches [190035] (27 species)
    not a true protein
  7. 2042883Species French bean (Phaseolus vulgaris) [TaxId:3885] [238518] (3 PDB entries)
  8. 2042889Domain d3wcrb_: 3wcr B: [238520]
    automated match to d1g8wa_
    complexed with br, nag

Details for d3wcrb_

PDB Entry: 3wcr (more details), 2.45 Å

PDB Description: crystal structure of plant lectin (ligand-free form)
PDB Compounds: (B:) Erythroagglutinin

SCOPe Domain Sequences for d3wcrb_:

Sequence, based on SEQRES records: (download)

>d3wcrb_ b.29.1.1 (B:) automated matches {French bean (Phaseolus vulgaris) [TaxId: 3885]}
asqtsfsfqrfnetnlilqrdatvsskgqlrltnvndngeptlsslgrafysapiqiwdn
ttgavasfatsftfnidvpnnsgpadglafvllpvgsqpkdkggllglfnnykydsnaht
vavefdtlynvhwdpkprhigidvnsiksiktttwdfvkgenaevlitydsstkllvasl
vypslktsfivsdtvdlksvlpewvivgftattgitkgnvetndilswsfasklsdgtts
ealnlanfa

Sequence, based on observed residues (ATOM records): (download)

>d3wcrb_ b.29.1.1 (B:) automated matches {French bean (Phaseolus vulgaris) [TaxId: 3885]}
asqtsfsfqrfnetnlilqrdatvsskgqlrltnvndngeptlsslgrafysapiqiwdn
ttgavasfatsftfnidvpnnsgpadglafvllpvgsqpkdkggllglfnnykydsnaht
vavefdtlykprhigidvnsiksiktttwdfvkgenaevlitydsstkllvaslvypslk
tsfivsdtvdlksvlpewvivgftattgitkgnvetndilswsfasklsnlanfa

SCOPe Domain Coordinates for d3wcrb_:

Click to download the PDB-style file with coordinates for d3wcrb_.
(The format of our PDB-style files is described here.)

Timeline for d3wcrb_: