Class a: All alpha proteins [46456] (284 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) |
Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
Protein automated matches [193445] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [193446] (18 PDB entries) |
Domain d3wkjf_: 3wkj F: [238516] Other proteins in same PDB: d3wkja_, d3wkje_ automated match to d3a6nf_ protein/DNA complex; complexed with cl, mn |
PDB Entry: 3wkj (more details), 2.8 Å
SCOPe Domain Sequences for d3wkjf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wkjf_ a.22.1.1 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]} rkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakr ktvtamdvvyalkrqgrtlygfgg
Timeline for d3wkjf_: