Lineage for d3wkja_ (3wkj A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1987252Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1987253Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 1987254Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 1987456Protein Histone H3 [47122] (6 species)
  7. 1987555Species Human (Homo sapiens) [TaxId:9606] [187038] (10 PDB entries)
  8. 1987571Domain d3wkja_: 3wkj A: [238514]
    Other proteins in same PDB: d3wkjb_, d3wkjc_, d3wkjd_, d3wkjf_, d3wkjg_, d3wkjh_
    automated match to d3afaa_
    protein/DNA complex; complexed with cl, mn

Details for d3wkja_

PDB Entry: 3wkj (more details), 2.8 Å

PDB Description: the nucleosome containing human tsh2b
PDB Compounds: (A:) Histone H3.1

SCOPe Domain Sequences for d3wkja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wkja_ a.22.1.1 (A:) Histone H3 {Human (Homo sapiens) [TaxId: 9606]}
phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeace
aylvglfedtnlcaihakrvtimpkdiqlarrirger

SCOPe Domain Coordinates for d3wkja_:

Click to download the PDB-style file with coordinates for d3wkja_.
(The format of our PDB-style files is described here.)

Timeline for d3wkja_: