Lineage for d3sfia1 (3sfi A:22-94)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1981564Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1982467Family a.4.1.0: automated matches [191447] (1 protein)
    not a true family
  6. 1982468Protein automated matches [190674] (22 species)
    not a true protein
  7. 1982558Species Mycobacterium tuberculosis [TaxId:1773] [232223] (13 PDB entries)
  8. 1982572Domain d3sfia1: 3sfi A:22-94 [238507]
    Other proteins in same PDB: d3sfia2
    automated match to d3g1ma1
    protein/DNA complex; complexed with 3sf

Details for d3sfia1

PDB Entry: 3sfi (more details), 2.31 Å

PDB Description: ethionamide boosters part 2: combining bioisosteric replacement and structure-based drug design to solve pharmacokinetic issues in a series of potent 1,2,4-oxadiazole ethr inhibitors.
PDB Compounds: (A:) Transcriptional regulatory repressor protein (TETR-family)

SCOPe Domain Sequences for d3sfia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sfia1 a.4.1.0 (A:22-94) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
gddrelailataenlledrpladisvddlakgagisrptfyfyfpskeavlltlldrvvn
qadmalqtlaenp

SCOPe Domain Coordinates for d3sfia1:

Click to download the PDB-style file with coordinates for d3sfia1.
(The format of our PDB-style files is described here.)

Timeline for d3sfia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3sfia2