SCOPe 2.07: Domain d4pp8d_: 4pp8 D:

Lineage for d4pp8d_ (4pp8 D:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein NK cell ligand RAE-1 beta [69683] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [69684] (2 PDB entries)

8. Domain d4pp8d_: 4pp8 D: [238500]
   Other proteins in same PDB: d4pp8a_, d4pp8b_
   automated match to d1jfma_
   complexed with gol

Details for d4pp8d_

PDB Entry: 4pp8, 1.95 Å

PDB Description: Crystal structure of murine NK cell ligand RAE-1 beta in complex with NKG2D

PDB Compounds: (D:) Retinoic acid early-inducible protein 1-beta

SCOPe Domain Sequences for d4pp8d_:

Sequence, based on SEQRES records:

>d4pp8d_ d.19.1.1 (D:) NK cell ligand RAE-1 beta {Mouse (Mus musculus) [TaxId: 10090]}
hslrcnltikdptpadplwyeakcfvgeililhlsninktmtsgdpgetanatevkkclt
qplknlcqklrnkvsntkvdthktngyphlqvtmiypqsqgrtpsatwefnisdsyfftf
ytenmswrsandesgvimnkwkddgefvkqlkflihecsqkmdeflkqsk

Sequence, based on observed residues (ATOM records):

>d4pp8d_ d.19.1.1 (D:) NK cell ligand RAE-1 beta {Mouse (Mus musculus) [TaxId: 10090]}
hslrcnltikdptpadplwyeakcfvgeililhlsniatevkkcltqplknlcqklrnkv
sntkvdthyphlqvtmiypqsqtpsatwefnisdsyfftfytenmswrsandesgvimnk
wkddgefvkqlkflihecsqkmdeflkqsk

Timeline for d4pp8d_:

• d4pp8d_ first appeared in SCOPe 2.03
  
• d4pp8d_ appears in SCOPe 2.06
  
• d4pp8d_ appears in the current release, SCOPe 2.08