Lineage for d4pp8a_ (4pp8 A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2558905Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2558906Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2558907Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 2559178Protein NK cell-activating receptor nkg2d [64453] (2 species)
  7. 2559187Species Mouse (Mus musculus) [TaxId:10090] [64454] (2 PDB entries)
  8. 2559189Domain d4pp8a_: 4pp8 A: [238498]
    Other proteins in same PDB: d4pp8c_, d4pp8d_
    automated match to d1hyra_
    complexed with gol

Details for d4pp8a_

PDB Entry: 4pp8 (more details), 1.95 Å

PDB Description: Crystal structure of murine NK cell ligand RAE-1 beta in complex with NKG2D
PDB Compounds: (A:) nkg2-d type II integral membrane protein

SCOPe Domain Sequences for d4pp8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pp8a_ d.169.1.1 (A:) NK cell-activating receptor nkg2d {Mouse (Mus musculus) [TaxId: 10090]}
megycgpcpnnwichrnncyqffneektwnqsqasclsqnssllkiyskeeqdflklvks
yhwmglvqipangswqwedgsslsynqltlveipkgscavygssfkaytedcanlntyic
mkrav

SCOPe Domain Coordinates for d4pp8a_:

Click to download the PDB-style file with coordinates for d4pp8a_.
(The format of our PDB-style files is described here.)

Timeline for d4pp8a_: