Lineage for d4pofb1 (4pof B:2-254)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2049950Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2051128Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 2052191Family b.40.4.0: automated matches [191416] (1 protein)
    not a true family
  6. 2052192Protein automated matches [190576] (33 species)
    not a true protein
  7. 2052275Species Pyrococcus furiosus [TaxId:186497] [238494] (2 PDB entries)
  8. 2052277Domain d4pofb1: 4pof B:2-254 [238497]
    Other proteins in same PDB: d4pofa2, d4pofb2, d4pofc2, d4pofd2, d4pofe2, d4poff2
    automated match to d2vl6a_
    complexed with zn

Details for d4pofb1

PDB Entry: 4pof (more details), 2.65 Å

PDB Description: PfMCM N-terminal domain without DNA
PDB Compounds: (B:) Cell division control protein 21

SCOPe Domain Sequences for d4pofb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pofb1 b.40.4.0 (B:2-254) automated matches {Pyrococcus furiosus [TaxId: 186497]}
dreemierfanflreytdedgnpvyrgkitdlltitpkrsvaidwmhlnsfdselahevi
enpeegisaaedaiqivlredfqredvgkiharfynlpetlmvkdigaehinkliqvegi
vtrvgeikpfvsvavfvckdcghemivpqkpyeslekvkkceqcgsknieldvnkssfvn
fqsfriqdrpetlkggemprfidgillddivdvalpgdrvivtgilrvvlekrektpifr
kilevnhiepvsk

SCOPe Domain Coordinates for d4pofb1:

Click to download the PDB-style file with coordinates for d4pofb1.
(The format of our PDB-style files is described here.)

Timeline for d4pofb1: