Lineage for d1kaca_ (1kac A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.21: Adenovirus fiber protein head domain (knob domain) [49834] (1 superfamily) Superfamily b.21.1: Adenovirus fiber protein head domain (knob domain) [49835] (1 family) 
Family b.21.1.1: Adenovirus fiber protein head domain (knob domain) [49836] (1 protein) Protein Adenovirus fiber protein head domain (knob domain) [49837] (3 species) 
Species Human adenovirus type 12 [TaxId:28282] [49840] (2 PDB entries) 
Domain d1kaca_: 1kac A: [23849]
Other proteins in same PDB: d1kacb_
Details for d1kaca_
PDB Entry: 1kac (more details), 2.6 Å
PDB Description: knob domain from adenovirus serotype 12 in complex with domain 1 of its cellular receptor car
SCOP Domain Sequences for d1kaca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kaca_ b.21.1.1 (A:) Adenovirus fiber protein head domain (knob domain) {Human adenovirus type 12}
tpydpltlwttpdpppncsliqeldakltlcltkngsivngivslvgvkgnllniqsttt
tvgvhlvfdeqgrlitstptalvpqaswgyrqgqsvstntvtnglgfmpnvsayprpnas
eaksqmvsltylqgdtskpitmkvafngitslngysltfmwsglsnyinqpfstpscsfs
yitqe
SCOP Domain Coordinates for d1kaca_:
Click to download the PDB-style file with coordinates for d1kaca_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1kaca_:
- d1kaca_ appears in SCOP 1.57
- d1kaca_ appears in the current release, SCOPe 2.08
View in 3D
