![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.28: Peptide methionine sulfoxide reductase [55068] (2 families) ![]() common fold is elaborated with additional secondary structures |
![]() | Family d.58.28.0: automated matches [233250] (1 protein) not a true family |
![]() | Protein automated matches [233251] (2 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [233252] (3 PDB entries) |
![]() | Domain d3pimb1: 3pim B:2-184 [238485] Other proteins in same PDB: d3pima2, d3pimb2 automated match to d3pima_ |
PDB Entry: 3pim (more details), 1.9 Å
SCOPe Domain Sequences for d3pimb1:
Sequence, based on SEQRES records: (download)
>d3pimb1 d.58.28.0 (B:2-184) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} sslisktikydpakdklitlacgcfwgtehmyrkylndrivdckvgyangeeskkdspss vsykrvcggdtdfaevlqvsynpkvitlreltdfffrihdpttsnsqgpdkgtqyrsglf ahsdadlkelakikeewqpkwgnkiatviepiknfydaeeyhqlyldknpqgyacpthyl rem
>d3pimb1 d.58.28.0 (B:2-184) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} sslisktikydpakdklitlacgcfwgtehmyrkylndrivdckvgyangeesykrvcgg dtdfaevlqvsynpkvitlreltdfffrihdpttsnsqgpkgtqyrsglfahsdadlkel akikeewqpkwgnkiatviepiknfydaeeyhqlyldknpqgyacpthylrem
Timeline for d3pimb1: