Lineage for d4ol0a_ (4ol0 A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1362078Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1362079Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1362829Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1363513Protein Ran [52609] (2 species)
  7. 1363514Species Dog (Canis familiaris) [TaxId:9615] [52610] (9 PDB entries)
    Uniprot P62825
  8. 1363531Domain d4ol0a_: 4ol0 A: [238480]
    automated match to d1a2kc_
    complexed with gtp, mg

Details for d4ol0a_

PDB Entry: 4ol0 (more details), 2.9 Å

PDB Description: Crystal structure of transportin-SR2, a karyopherin involved in human disease, in complex with Ran
PDB Compounds: (A:) GTP-binding nuclear protein ran

SCOPe Domain Sequences for d4ol0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ol0a_ c.37.1.8 (A:) Ran {Dog (Canis familiaris) [TaxId: 9615]}
qvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdta
gqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik
drkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvam

SCOPe Domain Coordinates for d4ol0a_:

Click to download the PDB-style file with coordinates for d4ol0a_.
(The format of our PDB-style files is described here.)

Timeline for d4ol0a_: