SCOPe 2.05: Domain d1qiuf1: 1qiu F:396-582

Lineage for d1qiuf1 (1qiu F:396-582)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
   sandwich, 10 strands in 2 sheets; greek-key

4. Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families)

5. Family b.21.1.1: Adenovirus fiber protein "knob" domain [49836] (2 proteins)
   automatically mapped to Pfam PF00541

6. Protein Adenovirus fiber protein "knob" domain [49837] (12 species)

7. Species Human adenovirus type 2 [TaxId:10515] [49839] (2 PDB entries)

8. Domain d1qiuf1: 1qiu F:396-582 [23848]
   Other proteins in same PDB: d1qiua2, d1qiub2, d1qiuc2, d1qiud2, d1qiue2, d1qiuf2

Details for d1qiuf1

PDB Entry: 1qiu, 2.4 Å

PDB Description: a triple beta-spiral in the adenovirus fibre shaft reveals a new structural motif for biological fibres

PDB Compounds: (F:) adenovirus fibre

SCOPe Domain Sequences for d1qiuf1:

Sequence; same for both SEQRES and ATOM records:

>d1qiuf1 b.21.1.1 (F:396-582) Adenovirus fiber protein "knob" domain {Human adenovirus type 2 [TaxId: 10515]}
ddkltlwttpdpspncrihsdndckftlvltkcgsqvlatvaalavsgdlssmtgtvasv
siflrfdqngvlmensslkkhywnfrngnstnanpytnavgfmpnllaypktqsqtaknn
ivsqvylhgdktkpmiltitlngtsestetsevstysmsftwswesgkyttetfatnsyt
fsyiaqe

Timeline for d1qiuf1:

• d1qiuf1 first appeared (with stable ids) in SCOP 1.55
  
• d1qiuf1 appears in SCOPe 2.04
  
• d1qiuf1 appears in SCOPe 2.06
  
• d1qiuf1 appears in the current release, SCOPe 2.08