SCOPe 2.03: Domain d4omcd1: 4omc D:110-442

Lineage for d4omcd1 (4omc D:110-442)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.41: Subtilisin-like [52742] (1 superfamily)
   3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3

4. Superfamily c.41.1: Subtilisin-like [52743] (3 families)

5. Family c.41.1.1: Subtilases [52744] (14 proteins)

6. Protein automated matches [190073] (11 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [238473] (1 PDB entry)

8. Domain d4omcd1: 4omc D:110-442 [238474]
   Other proteins in same PDB: d4omca2, d4omcc2, d4omcd2
   automated match to d1p8ja2
   complexed with ca, fmt, na

Details for d4omcd1

PDB Entry: 4omc, 2.3 Å

PDB Description: X-ray structure of human furin in complex with the competitive inhibitor meta-guanidinomethyl-Phac-RVR-Amba

PDB Compounds: (D:) Furin

SCOPe Domain Sequences for d4omcd1:

Sequence; same for both SEQRES and ATOM records:

>d4omcd1 c.41.1.1 (D:110-442) automated matches {Homo sapiens [TaxId: 9606]}
yqeptdpkfpqqwylsgvtqrdlnvkaawaqgytghgivvsilddgieknhpdlagnydp
gasfdvndqdpdpqprytqmndnrhgtrcagevaavanngvcgvgvaynariggvrmldg
evtdavearslglnpnhihiysaswgpeddgktvdgparlaeeaffrgvsqgrgglgsif
vwasgnggrehdscncdgytnsiytlsissatqfgnvpwyseacsstlattyssgnqnek
qivttdlrqkcteshtgtsasaplaagiialtleanknltwrdmqhlvvqtskpahlnan
dwatngvgrkvshsygyglldagamvalaqnwt

Timeline for d4omcd1:

• d4omcd1 is new in SCOPe 2.03-stable
  
• d4omcd1 appears in SCOPe 2.04
  
• d4omcd1 appears in the current release, SCOPe 2.08