Lineage for d4nt4a_ (4nt4 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1929110Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1929111Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1932524Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 1932525Protein automated matches [190417] (21 species)
    not a true protein
  7. 1932650Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [238471] (1 PDB entry)
  8. 1932651Domain d4nt4a_: 4nt4 A: [238472]
    automated match to d1ckia_
    complexed with gol, so4

Details for d4nt4a_

PDB Entry: 4nt4 (more details), 2.86 Å

PDB Description: crystal structure of the kinase domain of gilgamesh isoform i from drosophila melanogaster
PDB Compounds: (A:) Gilgamesh, isoform I

SCOPe Domain Sequences for d4nt4a_:

Sequence, based on SEQRES records: (download)

>d4nt4a_ d.144.1.0 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
avlmvgpnfrvgkkigcgnfgelrlgknlynnehvaikmepmkskapqlhleyrfykllg
shadnapdgipriyhlgtcggrynamvlellglsledlfnicarkfslktvlmiakqllh
rieyvhsrhliyrdvkpenfligrtstkrekiihiidfglakeyidldtnrhipyrehks
ltgtarymsinthmgreqsrrddlealghmfmyflrgslpwqglkadtlkeryqkigdtk
ratpievlcdghpeefatylryvrrldffetpdydflrrlfqdlfdrkgytdegefdwtg
kt

Sequence, based on observed residues (ATOM records): (download)

>d4nt4a_ d.144.1.0 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
avlmvgpnfrvgkkigcfgelrlgknlynnehvaikmepmkskapqlhleyrfykllgsh
adnapdgipriyhlgtcggrynamvlellglsledlfnicarkfslktvlmiakqllhri
eyvhsrhliyrdvkpenfligrtstkrekiihiidfglakeyidldtnrhipyrehkslt
gtarymsinthmgreqsrrddlealghmfmyflrgslpwqglkadtlkeryqkigdtkra
tpievlcdghpeefatylryvrrldffetpdydflrrlfqdlfdrkgytdegefdwtgkt

SCOPe Domain Coordinates for d4nt4a_:

Click to download the PDB-style file with coordinates for d4nt4a_.
(The format of our PDB-style files is described here.)

Timeline for d4nt4a_: