![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily) sandwich, 10 strands in 2 sheets; greek-key |
![]() | Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) ![]() |
![]() | Family b.21.1.1: Adenovirus fiber protein "knob" domain [49836] (2 proteins) automatically mapped to Pfam PF00541 |
![]() | Protein Adenovirus fiber protein "knob" domain [49837] (12 species) |
![]() | Species Human adenovirus type 2 [TaxId:10515] [49839] (2 PDB entries) |
![]() | Domain d1qiue1: 1qiu E:396-582 [23847] Other proteins in same PDB: d1qiua2, d1qiub2, d1qiuc2, d1qiud2, d1qiue2, d1qiuf2 |
PDB Entry: 1qiu (more details), 2.4 Å
SCOPe Domain Sequences for d1qiue1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qiue1 b.21.1.1 (E:396-582) Adenovirus fiber protein "knob" domain {Human adenovirus type 2 [TaxId: 10515]} ddkltlwttpdpspncrihsdndckftlvltkcgsqvlatvaalavsgdlssmtgtvasv siflrfdqngvlmensslkkhywnfrngnstnanpytnavgfmpnllaypktqsqtaknn ivsqvylhgdktkpmiltitlngtsestetsevstysmsftwswesgkyttetfatnsyt fsyiaqe
Timeline for d1qiue1: