Lineage for d4o9ga1 (4o9g A:1-136)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2080271Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2080272Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2080920Family b.82.1.0: automated matches [191354] (1 protein)
    not a true family
  6. 2080921Protein automated matches [190388] (23 species)
    not a true protein
  7. 2081105Species Thermoanaerobacterium thermosaccharolyticum [TaxId:1517] [238466] (4 PDB entries)
  8. 2081106Domain d4o9ga1: 4o9g A:1-136 [238468]
    Other proteins in same PDB: d4o9ga2, d4o9gb2
    automated match to d2paea1
    complexed with 4td, edo, t46; mutant

Details for d4o9ga1

PDB Entry: 4o9g (more details), 1.9 Å

PDB Description: Crystal structure of the H51N mutant of the 3,4-ketoisomerase QdtA from Thermoanaerobacterium thermosaccharolyticum in complex with TDP-4-keto-6-deoxyglucose
PDB Compounds: (A:) QdtA

SCOPe Domain Sequences for d4o9ga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4o9ga1 b.82.1.0 (A:1-136) automated matches {Thermoanaerobacterium thermosaccharolyticum [TaxId: 1517]}
mlynvalikfkdiadkyghltpiegkidipfdikrvyyitkvdkditrgynshkklhqvl
iclngsvkirlkipdeekiielndpsvglyigplvwremfdftegcvllvlaseyydetd
yirnydfyideakkrf

SCOPe Domain Coordinates for d4o9ga1:

Click to download the PDB-style file with coordinates for d4o9ga1.
(The format of our PDB-style files is described here.)

Timeline for d4o9ga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4o9ga2