![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
![]() | Superfamily a.22.1: Histone-fold [47113] (5 families) ![]() |
![]() | Family a.22.1.0: automated matches [238448] (1 protein) not a true family |
![]() | Protein automated matches [238450] (4 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [238452] (8 PDB entries) |
![]() | Domain d4nftb2: 4nft B:98-186 [238461] Other proteins in same PDB: d4nfta3, d4nftb3 automated match to d2jssa1 |
PDB Entry: 4nft (more details), 2.61 Å
SCOPe Domain Sequences for d4nftb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4nftb2 a.22.1.0 (B:98-186) automated matches {Human (Homo sapiens) [TaxId: 9606]} srsqraglqfpvgrihrhlksrttshgrvgataavysaaileyltaevlelagnaskdlk vkritprhlqlairgdeeldslikatiag
Timeline for d4nftb2: