Lineage for d4nftb1 (4nft B:2-95)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2311419Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2311420Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2312588Family a.22.1.0: automated matches [238448] (1 protein)
    not a true family
  6. 2312589Protein automated matches [238450] (4 species)
    not a true protein
  7. 2312599Species Human (Homo sapiens) [TaxId:9606] [238452] (7 PDB entries)
  8. 2312608Domain d4nftb1: 4nft B:2-95 [238460]
    Other proteins in same PDB: d4nfta3, d4nftb3
    automated match to d2jssa2

Details for d4nftb1

PDB Entry: 4nft (more details), 2.61 Å

PDB Description: crystal structure of human lnkh2b-h2a.z-anp32e
PDB Compounds: (B:) Histone H2B type 2-E, Histone H2A.Z

SCOPe Domain Sequences for d4nftb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nftb1 a.22.1.0 (B:2-95) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rkesysiyvykvlkqvhpdtgisskamgimnsfvndiferiageasrlahynkrstitsr
eiqtavrlllpgelakhavsegtkavtkytsskk

SCOPe Domain Coordinates for d4nftb1:

Click to download the PDB-style file with coordinates for d4nftb1.
(The format of our PDB-style files is described here.)

Timeline for d4nftb1: