Lineage for d4nftb1 (4nft B:1-95)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1725671Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1725672Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 1726366Family a.22.1.0: automated matches [238448] (1 protein)
    not a true family
  6. 1726367Protein automated matches [238450] (1 species)
    not a true protein
  7. 1726368Species Human (Homo sapiens) [TaxId:9606] [238452] (1 PDB entry)
  8. 1726371Domain d4nftb1: 4nft B:1-95 [238460]
    automated match to d2jssa2

Details for d4nftb1

PDB Entry: 4nft (more details), 2.61 Å

PDB Description: crystal structure of human lnkh2b-h2a.z-anp32e
PDB Compounds: (B:) Histone H2B type 2-E, Histone H2A.Z

SCOPe Domain Sequences for d4nftb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nftb1 a.22.1.0 (B:1-95) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mrkesysiyvykvlkqvhpdtgisskamgimnsfvndiferiageasrlahynkrstits
reiqtavrlllpgelakhavsegtkavtkytsskk

SCOPe Domain Coordinates for d4nftb1:

Click to download the PDB-style file with coordinates for d4nftb1.
(The format of our PDB-style files is described here.)

Timeline for d4nftb1: