SCOPe 2.03: Domain d4nftb1: 4nft B:1-95

Lineage for d4nftb1 (4nft B:1-95)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (5 families)

5. Family a.22.1.0: automated matches [238448] (1 protein)
   not a true family

6. Protein automated matches [238450] (1 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [238452] (1 PDB entry)

8. Domain d4nftb1: 4nft B:1-95 [238460]
   automated match to d2jssa2

Details for d4nftb1

PDB Entry: 4nft, 2.61 Å

PDB Description: crystal structure of human lnkh2b-h2a.z-anp32e

PDB Compounds: (B:) Histone H2B type 2-E, Histone H2A.Z

SCOPe Domain Sequences for d4nftb1:

Sequence; same for both SEQRES and ATOM records:

>d4nftb1 a.22.1.0 (B:1-95) automated matches {Homo sapiens [TaxId: 9606]}
mrkesysiyvykvlkqvhpdtgisskamgimnsfvndiferiageasrlahynkrstits
reiqtavrlllpgelakhavsegtkavtkytsskk

Timeline for d4nftb1:

• d4nftb1 is new in SCOPe 2.03-stable
  
• d4nftb1 appears in SCOPe 2.04
  
• d4nftb1 appears in the current release, SCOPe 2.08