Lineage for d4nfta1 (4nft A:2-95)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2698054Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2698055Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2699233Family a.22.1.0: automated matches [238448] (1 protein)
    not a true family
  6. 2699234Protein automated matches [238450] (4 species)
    not a true protein
  7. 2699238Species Human (Homo sapiens) [TaxId:9606] [238452] (8 PDB entries)
  8. 2699247Domain d4nfta1: 4nft A:2-95 [238458]
    Other proteins in same PDB: d4nfta3, d4nftb3
    automated match to d2jssa2

Details for d4nfta1

PDB Entry: 4nft (more details), 2.61 Å

PDB Description: crystal structure of human lnkh2b-h2a.z-anp32e
PDB Compounds: (A:) Histone H2B type 2-E, Histone H2A.Z

SCOPe Domain Sequences for d4nfta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nfta1 a.22.1.0 (A:2-95) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rkesysiyvykvlkqvhpdtgisskamgimnsfvndiferiageasrlahynkrstitsr
eiqtavrlllpgelakhavsegtkavtkytsskk

SCOPe Domain Coordinates for d4nfta1:

Click to download the PDB-style file with coordinates for d4nfta1.
(The format of our PDB-style files is described here.)

Timeline for d4nfta1: