SCOPe 2.06: Domain d4nftd1: 4nft D:5-93

Lineage for d4nftd1 (4nft D:5-93)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (5 families)

5. Family a.22.1.0: automated matches [238448] (1 protein)
   not a true family

6. Protein automated matches [238450] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [238452] (4 PDB entries)

8. Domain d4nftd1: 4nft D:5-93 [238454]
   Other proteins in same PDB: d4nfta3, d4nftb3
   automated match to d2jssa2

Details for d4nftd1

PDB Entry: 4nft, 2.61 Å

PDB Description: crystal structure of human lnkh2b-h2a.z-anp32e

PDB Compounds: (D:) Histone H2B type 2-E, Histone H2A.Z

SCOPe Domain Sequences for d4nftd1:

Sequence; same for both SEQRES and ATOM records:

>d4nftd1 a.22.1.0 (D:5-93) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sysiyvykvlkqvhpdtgisskamgimnsfvndiferiageasrlahynkrstitsreiq
tavrlllpgelakhavsegtkavtkytss

Timeline for d4nftd1:

• d4nftd1 first appeared in SCOPe 2.03
  
• d4nftd1 appears in SCOPe 2.05
  
• d4nftd1 appears in SCOPe 2.07
  
• d4nftd1 appears in the current release, SCOPe 2.08