Lineage for d1qiuc1 (1qiu C:396-582)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 12239Fold b.21: Adenovirus fiber protein head domain (knob domain) [49834] (1 superfamily)
  4. 12240Superfamily b.21.1: Adenovirus fiber protein head domain (knob domain) [49835] (1 family) (S)
  5. 12241Family b.21.1.1: Adenovirus fiber protein head domain (knob domain) [49836] (1 protein)
  6. 12242Protein Adenovirus fiber protein head domain (knob domain) [49837] (3 species)
  7. 12251Species Human adenovirus type 2 [TaxId:10515] [49839] (2 PDB entries)
  8. 12255Domain d1qiuc1: 1qiu C:396-582 [23845]
    Other proteins in same PDB: d1qiua2, d1qiub2, d1qiuc2, d1qiud2, d1qiue2, d1qiuf2

Details for d1qiuc1

PDB Entry: 1qiu (more details), 2.4 Å

PDB Description: a triple beta-spiral in the adenovirus fibre shaft reveals a new structural motif for biological fibres

SCOP Domain Sequences for d1qiuc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qiuc1 b.21.1.1 (C:396-582) Adenovirus fiber protein head domain (knob domain) {Human adenovirus type 2}
ddkltlwttpdpspncrihsdndckftlvltkcgsqvlatvaalavsgdlssmtgtvasv
siflrfdqngvlmensslkkhywnfrngnstnanpytnavgfmpnllaypktqsqtaknn
ivsqvylhgdktkpmiltitlngtsestetsevstysmsftwswesgkyttetfatnsyt
fsyiaqe

SCOP Domain Coordinates for d1qiuc1:

Click to download the PDB-style file with coordinates for d1qiuc1.
(The format of our PDB-style files is described here.)

Timeline for d1qiuc1: