Lineage for d4n6ta_ (4n6t A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2935698Superfamily d.17.1: Cystatin/monellin [54403] (7 families) (S)
    has a additional strand at the N-terminus
  5. 2935875Family d.17.1.0: automated matches [191407] (1 protein)
    not a true family
  6. 2935876Protein automated matches [190558] (13 species)
    not a true protein
  7. 2935877Species Artificial gene [TaxId:32630] [238445] (2 PDB entries)
  8. 2935878Domain d4n6ta_: 4n6t A: [238446]
    automated match to d2w9pa_

Details for d4n6ta_

PDB Entry: 4n6t (more details), 1.75 Å

PDB Description: Adhiron: a stable and versatile peptide display scaffold - full length adhiron
PDB Compounds: (A:) Adhiron

SCOPe Domain Sequences for d4n6ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n6ta_ d.17.1.0 (A:) automated matches {Artificial gene [TaxId: 32630]}
ensleieelarfavdehnkkenallefvrvvkakeqvvagtmyyltleakdggkkklyea
kvwvkpwenfkelqefkpv

SCOPe Domain Coordinates for d4n6ta_:

Click to download the PDB-style file with coordinates for d4n6ta_.
(The format of our PDB-style files is described here.)

Timeline for d4n6ta_: