Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (19 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [186842] (122 PDB entries) |
Domain d4ma1l1: 4ma1 L:1-107 [238443] Other proteins in same PDB: d4ma1c2, d4ma1f2, d4ma1l2 automated match to d1l7tl1 complexed with k, peg |
PDB Entry: 4ma1 (more details), 2.32 Å
SCOPe Domain Sequences for d4ma1l1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ma1l1 b.1.1.1 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]} dilmnqtplslpvslgdqasiscrssqyivhrngntylewylqkpgqspklliykvsnrf sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpytfgggtklelk
Timeline for d4ma1l1:
View in 3D Domains from other chains: (mouse over for more information) d4ma1c1, d4ma1c2, d4ma1f1, d4ma1f2 |