Class g: Small proteins [56992] (90 folds) |
Fold g.17: Cystine-knot cytokines [57500] (1 superfamily) disulfide-rich fold; common core is all-beta |
Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) |
Family g.17.1.4: Gonadodropin/Follitropin [57528] (4 proteins) |
Protein automated matches [194842] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [194843] (2 PDB entries) |
Domain d4mqwh_: 4mqw H: [238442] Other proteins in same PDB: d4mqwa_, d4mqwd_ automated match to d4ay9h_ complexed with edo, jef, nag |
PDB Entry: 4mqw (more details), 2.9 Å
SCOPe Domain Sequences for d4mqwh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mqwh_ g.17.1.4 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]} nsceltnitiaiekeecrfcisinttwcagycytrdlvykdparpkiqktctfkelvyet vrvpgcahhadslytypvatqchcgkcdsdstdctvrglgpsycsfge
Timeline for d4mqwh_:
View in 3D Domains from other chains: (mouse over for more information) d4mqwa_, d4mqwb_, d4mqwd_, d4mqwe_ |