SCOPe 2.05: Domain d4mqwb_: 4mqw B:

Lineage for d4mqwb_ (4mqw B:)

1. Root: SCOPe 2.05

2. Class g: Small proteins [56992] (92 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulfide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families)

5. Family g.17.1.4: Gonadodropin/Follitropin [57528] (4 proteins)

6. Protein Follicle stimulating hormone, follitropin, beta chain [64562] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [64563] (3 PDB entries)

8. Domain d4mqwb_: 4mqw B: [238440]
   Other proteins in same PDB: d4mqwa_, d4mqwd_, d4mqwg_
   automated match to d4ay9h_
   complexed with edo, jef, nag

Details for d4mqwb_

PDB Entry: 4mqw, 2.9 Å

PDB Description: structure of follicle-stimulating hormone in complex with the entire ectodomain of its receptor (p31)

PDB Compounds: (B:) follitropin subunit beta

SCOPe Domain Sequences for d4mqwb_:

Sequence; same for both SEQRES and ATOM records:

>d4mqwb_ g.17.1.4 (B:) Follicle stimulating hormone, follitropin, beta chain {Human (Homo sapiens) [TaxId: 9606]}
nsceltnitiaiekeecrfcisinttwcagycytrdlvykdparpkiqktctfkelvyet
vrvpgcahhadslytypvatqchcgkcdsdstdctvrglgpsycsfgem

Timeline for d4mqwb_:

• d4mqwb_ first appeared in SCOPe 2.03
  
• d4mqwb_ appears in SCOPe 2.04
  
• d4mqwb_ appears in SCOPe 2.06
  
• d4mqwb_ appears in the current release, SCOPe 2.08