Lineage for d1qiub1 (1qiu B:396-582)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
sandwich, 10 strands in 2 sheets; greek-keySuperfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) 
Family b.21.1.1: Adenovirus fiber protein "knob" domain [49836] (2 proteins)
automatically mapped to Pfam PF00541Protein Adenovirus fiber protein "knob" domain [49837] (18 species) Species Human adenovirus type 2 [TaxId:10515] [49839] (2 PDB entries) 
Domain d1qiub1: 1qiu B:396-582 [23844]
Other proteins in same PDB: d1qiua2, d1qiub2, d1qiuc2, d1qiud2, d1qiue2, d1qiuf2
Details for d1qiub1
PDB Entry: 1qiu (more details), 2.4 Å
PDB Description: a triple beta-spiral in the adenovirus fibre shaft reveals a new structural motif for biological fibres
PDB Compounds: (B:) adenovirus fibreSCOPe Domain Sequences for d1qiub1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qiub1 b.21.1.1 (B:396-582) Adenovirus fiber protein "knob" domain {Human adenovirus type 2 [TaxId: 10515]}
ddkltlwttpdpspncrihsdndckftlvltkcgsqvlatvaalavsgdlssmtgtvasv
siflrfdqngvlmensslkkhywnfrngnstnanpytnavgfmpnllaypktqsqtaknn
ivsqvylhgdktkpmiltitlngtsestetsevstysmsftwswesgkyttetfatnsyt
fsyiaqe
SCOPe Domain Coordinates for d1qiub1:
Click to download the PDB-style file with coordinates for d1qiub1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qiub1:
View in 3D
