SCOPe 2.08: Domain d4lvhl2: 4lvh L:111-210

Lineage for d4lvhl2 (4lvh L:111-210)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (15 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
Domain d4lvhl2: 4lvh L:111-210 [238437]
Other proteins in same PDB: d4lvhc1, d4lvhf1, d4lvhi1, d4lvhl1
automated match to d1l7tl2
complexed with ca

Details for d4lvhl2

PDB Entry: 4lvh (more details), 2.8 Å

PDB Description: insight into highly conserved h1 subtype-specific epitopes in influenza virus hemagglutinin

PDB Compounds: (L:) monoclonal antibody l-chain

SCOPe Domain Sequences for d4lvhl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lvhl2 b.1.1.2 (L:111-210) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkinvkwkidgserqngvlnswtdqds
kdstysmsstltldeyerhnsytceathktstspivksfn

SCOPe Domain Coordinates for d4lvhl2:

Click to download the PDB-style file with coordinates for d4lvhl2.
(The format of our PDB-style files is described here.)

Timeline for d4lvhl2: