Lineage for d4lvhl1 (4lvh L:1-110)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1519111Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1519112Protein automated matches [190740] (19 species)
    not a true protein
  7. 1520466Species Mouse (Mus musculus) [TaxId:10090] [188198] (388 PDB entries)
  8. 1521143Domain d4lvhl1: 4lvh L:1-110 [238436]
    Other proteins in same PDB: d4lvhc2, d4lvhf2, d4lvhi2, d4lvhl2
    automated match to d1l7tl1
    complexed with ca

Details for d4lvhl1

PDB Entry: 4lvh (more details), 2.8 Å

PDB Description: insight into highly conserved h1 subtype-specific epitopes in influenza virus hemagglutinin
PDB Compounds: (L:) monoclonal antibody l-chain

SCOPe Domain Sequences for d4lvhl1:

Sequence, based on SEQRES records: (download)

>d4lvhl1 b.1.1.0 (L:1-110) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqmtqspaslavspgqratitcrasesvsnyginfinwfqqkpgqppklliytasnkgtg
vparfsgsgsgtdftltinpveaedtanyfcqqtkevpytfgggtkleik

Sequence, based on observed residues (ATOM records): (download)

>d4lvhl1 b.1.1.0 (L:1-110) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqmtqspaslavspgqratitcraesvsnyginfinwfqqkpgqppklliytasnkgtgv
parfsgsgsgtdftltinpveaedtanyfcqqtkevpytfgggtkleik

SCOPe Domain Coordinates for d4lvhl1:

Click to download the PDB-style file with coordinates for d4lvhl1.
(The format of our PDB-style files is described here.)

Timeline for d4lvhl1: