SCOPe 2.03: Domain d4lvhl1: 4lvh L:1-110

Lineage for d4lvhl1 (4lvh L:1-110)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (23 species)
   not a true protein

7. Species Mus musculus [TaxId:10090] [227304] (35 PDB entries)

8. Domain d4lvhl1: 4lvh L:1-110 [238436]
   Other proteins in same PDB: d4lvhc2, d4lvhf2, d4lvhl2
   automated match to d1l7tl1
   complexed with ca

Details for d4lvhl1

PDB Entry: 4lvh, 2.8 Å

PDB Description: insight into highly conserved h1 subtype-specific epitopes in influenza virus hemagglutinin

PDB Compounds: (L:) monoclonal antibody l-chain

SCOPe Domain Sequences for d4lvhl1:

Sequence, based on SEQRES records:

>d4lvhl1 b.1.1.0 (L:1-110) automated matches {Mus musculus [TaxId: 10090]}
iqmtqspaslavspgqratitcrasesvsnyginfinwfqqkpgqppklliytasnkgtg
vparfsgsgsgtdftltinpveaedtanyfcqqtkevpytfgggtkleik

Sequence, based on observed residues (ATOM records):

>d4lvhl1 b.1.1.0 (L:1-110) automated matches {Mus musculus [TaxId: 10090]}
iqmtqspaslavspgqratitcraesvsnyginfinwfqqkpgqppklliytasnkgtgv
parfsgsgsgtdftltinpveaedtanyfcqqtkevpytfgggtkleik

Timeline for d4lvhl1:

• d4lvhl1 is new in SCOPe 2.03-stable
  
• d4lvhl1 appears in SCOPe 2.04
  
• d4lvhl1 appears in the current release, SCOPe 2.08