Lineage for d4lvhf2 (4lvh F:111-210)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2753350Domain d4lvhf2: 4lvh F:111-210 [238435]
    Other proteins in same PDB: d4lvhc1, d4lvhf1, d4lvhi1, d4lvhl1
    automated match to d1l7tl2
    complexed with ca

Details for d4lvhf2

PDB Entry: 4lvh (more details), 2.8 Å

PDB Description: insight into highly conserved h1 subtype-specific epitopes in influenza virus hemagglutinin
PDB Compounds: (F:) monoclonal antibody l-chain

SCOPe Domain Sequences for d4lvhf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lvhf2 b.1.1.2 (F:111-210) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkinvkwkidgserqngvlnswtdqds
kdstysmsstltldeyerhnsytceathktstspivksfn

SCOPe Domain Coordinates for d4lvhf2:

Click to download the PDB-style file with coordinates for d4lvhf2.
(The format of our PDB-style files is described here.)

Timeline for d4lvhf2: