SCOPe 2.03: Domain d4lhma2: 4lhm A:71-335

Lineage for d4lhma2 (4lhm A:71-335)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.27: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52417] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like

4. Superfamily c.27.1: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52418] (1 family)
   automatically mapped to Pfam PF00591

5. Family c.27.1.1: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52419] (3 proteins)

6. Protein Thymidine phosphorylase [52420] (2 species)

7. Species Escherichia coli [TaxId:562] [52421] (7 PDB entries)

8. Domain d4lhma2: 4lhm A:71-335 [238427]
   Other proteins in same PDB: d4lhma1, d4lhma3
   automated match to d2tpta2
   complexed with azz, gol, so4

Details for d4lhma2

PDB Entry: 4lhm, 1.52 Å

PDB Description: Thymidine phosphorylase from E.coli with 3'-azido-3'-deoxythymidine

PDB Compounds: (A:) thymidine phosphorylase

SCOPe Domain Sequences for d4lhma2:

Sequence; same for both SEQRES and ATOM records:

>d4lhma2 c.27.1.1 (A:71-335) Thymidine phosphorylase {Escherichia coli [TaxId: 562]}
dwkslhlngpivdkhstggvgdvtslmlgpmvaacggyipmisgrglghtggtldklesi
pgfdifpddnrfreiikdvgvaiigqtsslapadkrfyatrditatvdsiplitasilak
klaegldalvmdvkvgsgafmptyelsealaeaivgvangagvrttalltdmnqvlassa
gnavevreavqfltgeyrnprlfdvtmalcvemlisgklakddaearaklqavldngkaa
evfgrmvaaqkgptdfvenyakylp

Timeline for d4lhma2:

• d4lhma2 is new in SCOPe 2.03-stable
  
• d4lhma2 appears in SCOPe 2.04
  
• d4lhma2 appears in the current release, SCOPe 2.08