Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.27: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52417] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like |
Superfamily c.27.1: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52418] (1 family) automatically mapped to Pfam PF00591 |
Family c.27.1.1: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52419] (3 proteins) |
Protein Thymidine phosphorylase [52420] (2 species) |
Species Escherichia coli [TaxId:562] [52421] (7 PDB entries) |
Domain d4lhma2: 4lhm A:71-335 [238427] Other proteins in same PDB: d4lhma1, d4lhma3 automated match to d2tpta2 complexed with azz, gol, so4 |
PDB Entry: 4lhm (more details), 1.52 Å
SCOPe Domain Sequences for d4lhma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lhma2 c.27.1.1 (A:71-335) Thymidine phosphorylase {Escherichia coli [TaxId: 562]} dwkslhlngpivdkhstggvgdvtslmlgpmvaacggyipmisgrglghtggtldklesi pgfdifpddnrfreiikdvgvaiigqtsslapadkrfyatrditatvdsiplitasilak klaegldalvmdvkvgsgafmptyelsealaeaivgvangagvrttalltdmnqvlassa gnavevreavqfltgeyrnprlfdvtmalcvemlisgklakddaearaklqavldngkaa evfgrmvaaqkgptdfvenyakylp
Timeline for d4lhma2: