SCOPe 2.07: Domain d4lhma1: 4lhm A:2-70

Lineage for d4lhma1 (4lhm A:2-70)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.46: Methionine synthase domain-like [47643] (3 superfamilies)
   4 helices; bundle, left-handed twist; right-handed superhelix

4. Superfamily a.46.2: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47648] (2 families)
   automatically mapped to Pfam PF02885

5. Family a.46.2.1: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47649] (3 proteins)

6. Protein Thymidine phosphorylase [47650] (2 species)

7. Species Escherichia coli [TaxId:562] [47651] (7 PDB entries)

8. Domain d4lhma1: 4lhm A:2-70 [238426]
   Other proteins in same PDB: d4lhma2, d4lhma3, d4lhma4
   automated match to d2tpta1
   complexed with azz, gol, so4

Details for d4lhma1

PDB Entry: 4lhm, 1.52 Å

PDB Description: Thymidine phosphorylase from E.coli with 3'-azido-3'-deoxythymidine

PDB Compounds: (A:) thymidine phosphorylase

SCOPe Domain Sequences for d4lhma1:

Sequence; same for both SEQRES and ATOM records:

>d4lhma1 a.46.2.1 (A:2-70) Thymidine phosphorylase {Escherichia coli [TaxId: 562]}
flaqeiirkkrdghalsdeeirffingirdntisegqiaalamtiffhdmtmpervsltm
amrdsgtvl

Timeline for d4lhma1:

• d4lhma1 first appeared in SCOPe 2.03
  
• d4lhma1 appears in SCOPe 2.06
  
• d4lhma1 appears in the current release, SCOPe 2.08