Lineage for d1qhva_ (1qhv A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1778904Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 1778905Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) (S)
  5. 1778906Family b.21.1.1: Adenovirus fiber protein "knob" domain [49836] (2 proteins)
    automatically mapped to Pfam PF00541
  6. 1778907Protein Adenovirus fiber protein "knob" domain [49837] (12 species)
  7. 1778983Species Human adenovirus type 2 [TaxId:10515] [49839] (2 PDB entries)
  8. 1778984Domain d1qhva_: 1qhv A: [23842]
    complexed with so4

Details for d1qhva_

PDB Entry: 1qhv (more details), 1.51 Å

PDB Description: human adenovirus serotype 2 fibre head
PDB Compounds: (A:) protein (adenovirus fibre)

SCOPe Domain Sequences for d1qhva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qhva_ b.21.1.1 (A:) Adenovirus fiber protein "knob" domain {Human adenovirus type 2 [TaxId: 10515]}
aitignknddkltlwttpdpspncrihsdndckftlvltkcgsqvlatvaalavsgdlss
mtgtvasvsiflrfdqngvlmensslkkhywnfrngnstnanpytnavgfmpnllaypkt
qsqtaknnivsqvylhgdktkpmiltitlngtsestetsevstysmsftwswesgkytte
tfatnsytfsyiaqe

SCOPe Domain Coordinates for d1qhva_:

Click to download the PDB-style file with coordinates for d1qhva_.
(The format of our PDB-style files is described here.)

Timeline for d1qhva_: