SCOPe 2.08: Domain d1knba_: 1knb A:

Lineage for d1knba_ (1knb A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
   sandwich, 10 strands in 2 sheets; greek-key

4. Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families)

5. Family b.21.1.1: Adenovirus fiber protein 'knob' domain [49836] (2 proteins)
   automatically mapped to Pfam PF00541

6. Protein Adenovirus fiber protein 'knob' domain [49837] (18 species)

7. Species Human adenovirus type 5 [TaxId:28285] [49838] (2 PDB entries)

8. Domain d1knba_: 1knb A: [23841]

Details for d1knba_

PDB Entry: 1knb, 1.7 Å

PDB Description: crystal structure of the receptor-binding domain of adenovirus type 5 fiber protein at 1.7 angstroms resolution

PDB Compounds: (A:) adenovirus type 5 fiber protein

SCOPe Domain Sequences for d1knba_:

Sequence; same for both SEQRES and ATOM records:

>d1knba_ b.21.1.1 (A:) Adenovirus fiber protein 'knob' domain {Human adenovirus type 5 [TaxId: 28285]}
ndkltlwttpapspncrlnaekdakltlvltkcgsqilatvsvlavkgslapisgtvqsa
hliirfdengvllnnsfldpeywnfrngdltegtaytnavgfmpnlsaypkshgktaksn
ivsqvylngdktkpvtltitlngtqetgdttpsaysmsfswdwsghnyineifatssytf
syiaqe

Timeline for d1knba_:

• d1knba_ first appeared (with stable ids) in SCOP 1.55, called d1knb__
  
• d1knba_ appears in SCOPe 2.07