| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) ![]() |
| Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) |
| Protein Green fluorescent protein, GFP [54513] (5 species) |
| Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (272 PDB entries) Uniprot P42212 |
| Domain d4kw4a_: 4kw4 A: [238405] automated match to d2h9wa_ |
PDB Entry: 4kw4 (more details), 1.75 Å
SCOPe Domain Sequences for d4kw4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kw4a_ d.22.1.1 (A:) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
skgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlv
ttlgygvqcfarypdhmkqhdffksampegyvqertiffkddgnyktraevkfegdtlvn
rielkgidfkedgnilghkleynynhhkvyitadkqkngikvnfktrhniedgsvqladh
yqqntpigdgpvllpdnhylhthsklskdpnekrdhmvllefvtaagitl
Timeline for d4kw4a_: