Lineage for d4kw4a_ (4kw4 A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1407410Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 1407411Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 1407412Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 1407416Protein Green fluorescent protein, GFP [54513] (4 species)
  7. 1407422Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (151 PDB entries)
    Uniprot P42212
  8. 1407527Domain d4kw4a_: 4kw4 A: [238405]
    automated match to d2h9wa_

Details for d4kw4a_

PDB Entry: 4kw4 (more details), 1.75 Å

PDB Description: crystal structure of green fluorescent protein
PDB Compounds: (A:) Green fluorescent protein

SCOPe Domain Sequences for d4kw4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kw4a_ d.22.1.1 (A:) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
skgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlv
ttlgygvqcfarypdhmkqhdffksampegyvqertiffkddgnyktraevkfegdtlvn
rielkgidfkedgnilghkleynynhhkvyitadkqkngikvnfktrhniedgsvqladh
yqqntpigdgpvllpdnhylhthsklskdpnekrdhmvllefvtaagitl

SCOPe Domain Coordinates for d4kw4a_:

Click to download the PDB-style file with coordinates for d4kw4a_.
(The format of our PDB-style files is described here.)

Timeline for d4kw4a_: