Lineage for d4h8wl2 (4h8w L:109-209)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2750104Domain d4h8wl2: 4h8w L:109-209 [238403]
    Other proteins in same PDB: d4h8wc1, d4h8wc2, d4h8wh_, d4h8wl1
    automated match to d3tnnd2
    complexed with gol, mrd, nag

Details for d4h8wl2

PDB Entry: 4h8w (more details), 1.85 Å

PDB Description: crystal structure of non-neutralizing and adcc-potent antibody n5-i5 in complex with hiv-1 clade a/e gp120 and scd4.
PDB Compounds: (L:) Fab light chain of ADCC and non-neutralizing anti-HIV-1 antibody N5-i5

SCOPe Domain Sequences for d4h8wl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h8wl2 b.1.1.2 (L:109-209) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvap

SCOPe Domain Coordinates for d4h8wl2:

Click to download the PDB-style file with coordinates for d4h8wl2.
(The format of our PDB-style files is described here.)

Timeline for d4h8wl2: