Lineage for d4h8wl1 (4h8w L:3-108)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (24 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1030 PDB entries)
  8. 2355852Domain d4h8wl1: 4h8w L:3-108 [238402]
    Other proteins in same PDB: d4h8wc1, d4h8wc2, d4h8wl2
    automated match to d3tnnd1
    complexed with gol, mrd, nag

Details for d4h8wl1

PDB Entry: 4h8w (more details), 1.85 Å

PDB Description: crystal structure of non-neutralizing and adcc-potent antibody n5-i5 in complex with hiv-1 clade a/e gp120 and scd4.
PDB Compounds: (L:) Fab light chain of ADCC and non-neutralizing anti-HIV-1 antibody N5-i5

SCOPe Domain Sequences for d4h8wl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h8wl1 b.1.1.0 (L:3-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
saltqpasvsgspgqsitisctgtssdvgsynfvswyqqhpgkapklmiyevserpsgis
nrfsgsksgntasltisglqaedeadyycssyagsttfrvfgggtkltvrg

SCOPe Domain Coordinates for d4h8wl1:

Click to download the PDB-style file with coordinates for d4h8wl1.
(The format of our PDB-style files is described here.)

Timeline for d4h8wl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4h8wl2