Lineage for d1aol__ (1aol -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 12233Fold b.20: F-MuLV receptor-binding domain [49829] (1 superfamily)
  4. 12234Superfamily b.20.1: F-MuLV receptor-binding domain [49830] (1 family) (S)
  5. 12235Family b.20.1.1: F-MuLV receptor-binding domain [49831] (1 protein)
  6. 12236Protein F-MuLV receptor-binding domain [49832] (1 species)
  7. 12237Species Friend murine leukemia virus [TaxId:11795] [49833] (1 PDB entry)
  8. 12238Domain d1aol__: 1aol - [23840]

Details for d1aol__

PDB Entry: 1aol (more details), 2 Å

PDB Description: friend murine leukemia virus receptor-binding domain

SCOP Domain Sequences for d1aol__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aol__ b.20.1.1 (-) F-MuLV receptor-binding domain {Friend murine leukemia virus}
qvynitwevtngdretvwaisgnhplwtwwpvltpdlcmlalsgpphwgleyqapysspp
gppccsgssgssagcsrdcdepltsltprcntawnrlkldqvthkssegfyvcpgshrpr
eakscggpdsfycaswgcettgrvywkpssswdyitvdnnlttsqavqvckdnkwcnpla
iqftnagkqvtswttghywglrlyvsgrdpgltfgirlryqnlgprvp

SCOP Domain Coordinates for d1aol__:

Click to download the PDB-style file with coordinates for d1aol__.
(The format of our PDB-style files is described here.)

Timeline for d1aol__: