![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.20: ENV polyprotein, receptor-binding domain [49829] (1 superfamily) sandwich; 9 strands in 2 sheets; greek-key; contains a few helices in loop regions |
![]() | Superfamily b.20.1: ENV polyprotein, receptor-binding domain [49830] (1 family) ![]() automatically mapped to Pfam PF00429 |
![]() | Family b.20.1.1: ENV polyprotein, receptor-binding domain [49831] (2 proteins) |
![]() | Protein F-MuLV receptor-binding domain [49832] (1 species) |
![]() | Species Friend murine leukemia virus [TaxId:11795] [49833] (1 PDB entry) |
![]() | Domain d1aola_: 1aol A: [23840] complexed with nag, zn |
PDB Entry: 1aol (more details), 2 Å
SCOPe Domain Sequences for d1aola_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aola_ b.20.1.1 (A:) F-MuLV receptor-binding domain {Friend murine leukemia virus [TaxId: 11795]} qvynitwevtngdretvwaisgnhplwtwwpvltpdlcmlalsgpphwgleyqapysspp gppccsgssgssagcsrdcdepltsltprcntawnrlkldqvthkssegfyvcpgshrpr eakscggpdsfycaswgcettgrvywkpssswdyitvdnnlttsqavqvckdnkwcnpla iqftnagkqvtswttghywglrlyvsgrdpgltfgirlryqnlgprvp
Timeline for d1aola_: