Lineage for d1aola_ (1aol A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2776817Fold b.20: ENV polyprotein, receptor-binding domain [49829] (1 superfamily)
    sandwich; 9 strands in 2 sheets; greek-key; contains a few helices in loop regions
  4. 2776818Superfamily b.20.1: ENV polyprotein, receptor-binding domain [49830] (1 family) (S)
    automatically mapped to Pfam PF00429
  5. 2776819Family b.20.1.1: ENV polyprotein, receptor-binding domain [49831] (2 proteins)
  6. 2776820Protein F-MuLV receptor-binding domain [49832] (1 species)
  7. 2776821Species Friend murine leukemia virus [TaxId:11795] [49833] (1 PDB entry)
  8. 2776822Domain d1aola_: 1aol A: [23840]
    complexed with nag, zn

Details for d1aola_

PDB Entry: 1aol (more details), 2 Å

PDB Description: friend murine leukemia virus receptor-binding domain
PDB Compounds: (A:) gp70

SCOPe Domain Sequences for d1aola_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aola_ b.20.1.1 (A:) F-MuLV receptor-binding domain {Friend murine leukemia virus [TaxId: 11795]}
qvynitwevtngdretvwaisgnhplwtwwpvltpdlcmlalsgpphwgleyqapysspp
gppccsgssgssagcsrdcdepltsltprcntawnrlkldqvthkssegfyvcpgshrpr
eakscggpdsfycaswgcettgrvywkpssswdyitvdnnlttsqavqvckdnkwcnpla
iqftnagkqvtswttghywglrlyvsgrdpgltfgirlryqnlgprvp

SCOPe Domain Coordinates for d1aola_:

Click to download the PDB-style file with coordinates for d1aola_.
(The format of our PDB-style files is described here.)

Timeline for d1aola_: