Lineage for d4jzjb2 (4jzj B:114-219)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1294263Protein automated matches [190374] (12 species)
    not a true protein
  7. 1295262Species Mus musculus [TaxId:10090] [238130] (4 PDB entries)
  8. 1295266Domain d4jzjb2: 4jzj B:114-219 [238397]
    Other proteins in same PDB: d4jzjb1
    automated match to d1n0xl2
    complexed with gol, nag

Details for d4jzjb2

PDB Entry: 4jzj (more details), 2.8 Å

PDB Description: crystal structure of receptor-fab complex
PDB Compounds: (B:) Fab light chain

SCOPe Domain Sequences for d4jzjb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jzjb2 b.1.1.2 (B:114-219) automated matches {Mus musculus [TaxId: 10090]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d4jzjb2:

Click to download the PDB-style file with coordinates for d4jzjb2.
(The format of our PDB-style files is described here.)

Timeline for d4jzjb2: