Lineage for d1flce1 (1flc E:151-306)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2040266Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2040267Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2040890Family b.19.1.3: Hemagglutinin domain of haemagglutinin-esterase-fusion glycoprotein HEF1 [49826] (1 protein)
    automatically mapped to Pfam PF02710
  6. 2040891Protein Hemagglutinin domain of haemagglutinin-esterase-fusion glycoprotein HEF1 [49827] (1 species)
    includes irregular N- and C-terminal extensions
  7. 2040892Species Influenza C virus [TaxId:11552] [49828] (1 PDB entry)
  8. 2040895Domain d1flce1: 1flc E:151-306 [23839]
    Other proteins in same PDB: d1flca2, d1flcb_, d1flcc2, d1flcd_, d1flce2, d1flcf_

Details for d1flce1

PDB Entry: 1flc (more details), 3.2 Å

PDB Description: x-ray structure of the haemagglutinin-esterase-fusion glycoprotein of influenza c virus
PDB Compounds: (E:) haemagglutinin-esterase-fusion glycoprotein

SCOPe Domain Sequences for d1flce1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1flce1 b.19.1.3 (E:151-306) Hemagglutinin domain of haemagglutinin-esterase-fusion glycoprotein HEF1 {Influenza C virus [TaxId: 11552]}
cmslvnaldktiplqvtagtagncnnsflknpalytqevkpsenkcgkenlafftlptqf
gtyecklhlvascyfiydskevynkrgcdnyfqviydsfgkvvggldnrvspytgnsgdt
ptmqcdmlqlkpgrysvrssprfllmpersycfdmk

SCOPe Domain Coordinates for d1flce1:

Click to download the PDB-style file with coordinates for d1flce1.
(The format of our PDB-style files is described here.)

Timeline for d1flce1: