Lineage for d4k1la_ (4k1l A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1346342Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1346343Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1346668Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 1346695Protein 11-beta-hydroxysteroid dehydrogenase 1 [117423] (3 species)
  7. 1346711Species Human (Homo sapiens) [TaxId:9606] [117424] (24 PDB entries)
    Uniprot P28845
  8. 1346736Domain d4k1la_: 4k1l A: [238381]
    automated match to d1xu9a_
    complexed with ndp, sff

Details for d4k1la_

PDB Entry: 4k1l (more details), 1.96 Å

PDB Description: 4,4-Dioxo-5,6-dihydro-[1,4,3]oxathiazines, a novel class of 11 beta-HSD1 inhibitors for the treatment of diabetes
PDB Compounds: (A:) Corticosteroid 11-beta-dehydrogenase isozyme 1

SCOPe Domain Sequences for d4k1la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k1la_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]}
qplneefrpemlqgkkvivtgaskgigremayhlakmgahvvvtarsketlqkvvshcle
lgaasahyiagtmedmtfaeqfvaqagklmggldmlilnhitntslnlfhddihhvrksm
evnflsyvvltvaalpmlkqsngsivvvsslagkvaypmvaaysaskfaldgffssirke
ysvsrvnvsitlcvlglidtetamkavsgivhmqaapkeecaleiikggalrqeevyyds
slwttllirnpsrkileflysts

SCOPe Domain Coordinates for d4k1la_:

Click to download the PDB-style file with coordinates for d4k1la_.
(The format of our PDB-style files is described here.)

Timeline for d4k1la_: