SCOPe 2.05: Domain d4k0na2: 4k0n A:92-238

Lineage for d4k0na2 (4k0n A:92-238)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein automated matches [226848] (11 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224956] (38 PDB entries)

8. Domain d4k0na2: 4k0n A:92-238 [238380]
   Other proteins in same PDB: d4k0na1
   automated match to d3o3ta2
   complexed with mli; mutant

Details for d4k0na2

PDB Entry: 4k0n, 1.25 Å

PDB Description: crystal structure of human clic1 c24a mutant

PDB Compounds: (A:) chloride intracellular channel protein 1

SCOPe Domain Sequences for d4k0na2:

Sequence; same for both SEQRES and ATOM records:

>d4k0na2 a.45.1.1 (A:92-238) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rypklaalnpesntagldifakfsayiknsnpalndnlekgllkalkvldnyltsplpee
vdetsaedegvsqrkfldgneltladcnllpklhivqvvckkyrgftipeafrgvhryls
nayareefastcpddeeielayeqvak

Timeline for d4k0na2:

• d4k0na2 first appeared in SCOPe 2.03
  
• d4k0na2 appears in SCOPe 2.04
  
• d4k0na2 appears in SCOPe 2.06
  
• d4k0na2 appears in the current release, SCOPe 2.08